PNC27 Kit

Description

🧪 Product Profile: PNC27

Product Name: PNC27 peptide
CAS Numbers: 392661-17-5; 1159861-00-3
Category: Anticancer peptide; research-grade bioactive compound
Form: Lyophilized white powder for laboratory use
Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: 4032.13 g/mol
Purity: ≥98% (HPLC); single impurity ≤2%

🔬 Mechanism of Action

PNC27 exerts selective anticancer activity through a dual-domain structure:

• HDM-2 Binding Domain: Corresponding to residues 12-26 of the tumor suppressor protein p53, enabling specific recognition of membrane-bound HDM-2 (a p53-negative regulator overexpressed on cancer cells).
• Transmembrane-Penetrating Domain: Facilitates insertion into cancer cell membranes, inducing membranolysis (physical disruption of lipid bilayers) while sparing normal cells lacking surface HDM-2.

🧫 Key Properties

• Amino Acid Sequence (1-letter code):
  PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
• Solubility: Highly soluble in aqueous buffers (PBS, water for injection); slightly soluble in ethanol
• Storage Stability:
  • Lyophilized form: -20°C to -80°C for 24 months (desiccated, protected from light)
  • Reconstituted solution: Use within 24 hours or aliquot and freeze at -80°C
• Physical Characteristics: Amorphous powder; endotoxin level ≤50 EU/mg

🩺 Preclinical Research Applications

PNC27 demonstrates efficacy across multiple cancer models:

• Solid Tumors: Pancreatic cancer, breast cancer, melanoma, and glioblastoma (in vitro and xenograft studies)
• Hematological Malignancies: Leukemia cell lines (e.g., K562, Jurkat)
• Mechanistic Studies: Investigation of HDM-2 membrane localization as a cancer-specific biomarker

⚙️ Handling & Experimental Use

• Reconstitution: Dissolve in sterile water or 0.9% saline to working concentrations (typically 1-10 mg/mL)
• Administration Routes: Intratumoral injection, intravenous infusion, or cell culture supplementation
• Dosing Considerations:
  • In vitro: 5-50 μM for cancer cell viability assays
  • In vivo: 0.1-1 mg/kg in murine models (adjust based on tumor type)

📌 Supplier Specifications

• Packaging: 1mg, 10mg, 50mg, or custom vials (vacuum-sealed under nitrogen)
• Quality Control:
  • Peptide content ≥75% (amino acid analysis)
  • Moisture ≤10% (Karl Fischer method)
  • Sterility: Aseptically filtered (0.22 μm) for cell culture use